A Helping Hand for Your Research

Phone: 610-945-2007
Fax: 877-271-1876

EN CH

Purified G proteins

PRODUCT CENTER

Arl1 Protein Q71L mutant

Price$239.00
BrandNewEastBio   
Place of OriginUSA
Catalog Number10156
ImmunogenE. coli
Size100μl
Technical InformationView technical data
  • Data Sheet
  • Reference
Purchase by sweeping
  • Summary

    Arl1 Protein Q71L mutant [10156]
    [25 µg]


    Catalog Number:  10156
    Product Name:  Arl1 Protein Q71L mutant
    Synonyms:  ADP-ribosylation factor-like 1, ARFL1
    Source:   Human, recombinant full length, His6-tag
    Expression Host:   E. coli
    Molecular Weight:   20 kDa
    Purity:   >95% by SDS-PAGE
    Introduction:   Arl1 is a member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform.
    Amino Acid Sequence   (1-181, Q71L)
    MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWD 
    LGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAM 
    TSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
    Properties
    Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
    Physical Appearance (form):  White or clear
    Concentration:  1 mg/mL
    Storage:   -80°C
    Preparation Instructions:  
    Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arl1 Q71L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining
    References:  
    1. Hong, J.-X. et al., J. Biol. Chem. 273: 15872-15876, 1998. 
    2. Zhang, G.-F. et al., J. Biol. Chem. 270: 21-24, 1995.
    Datasheet:  


      no data