A Helping Hand for Your Research

Phone: 610-945-2007
Fax: 877-271-1876

EN CH

Purified G proteins

PRODUCT CENTER

CST3 Protein

Price$239.00
BrandNewEastBio   
Place of OriginUSA
Catalog Number10157
ImmunogenE. coli
Size100μl
Technical InformationView technical data
  • Data Sheet
  • Reference
Purchase by sweeping
  • Summary

    CST3 Protein [10157]
    [100 µg]


    Catalog Number:  10157
    Product Name:  CST3 Protein
    Synonyms:  Cystatin C, Cystatin 3, CYSC
    Source:    Human, recombinant full length, His6-tag
    Expression Host:    E. coli
    Molecular Weight:   16 kDa
    Purity:   >95% by SDS-PAGE
    Introduction:   Cystatin C, which belongs to the type 2 cystatin gene family, is a potent inhibitor of lysosomal proteinases. It regulates the activity of cathepsin S, a protease with central regulatory functions in retinal pigment epithelial (RPE) cells.
    Amino Acid Sequence   (1-146)
    MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDM 
    YHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQG 
    TMTLSKSTCQDA
    Properties
    Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
    Physical Appearance (form):  White or clear
    Concentration:  1 mg/mL
    Storage:   -80°C
    Preparation Instructions:  
    Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged CST3 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.
    References:  
    1. Paraoan, L. et al., Traffic 5: 884-895, 2004. 
    2. Ratnayaka, A. et al., Exp. Eye Res. 84: 1135-1139, 2007. 
    3. Zurdel, J. et al., Brit. J. Ophthal. 86: 214-219, 2002.
    Datasheet:  


      no data