A Helping Hand for Your Research

Phone: 610-945-2007
Fax:

EN CH

G Proteins and Oncogene

PRODUCT CENTER

Arl3 Protein Q71L mutant

Price$239.00
BrandNewEastBio   
Place of OriginUSA
Catalog Number10166
ImmunogenE. coli
Size25 μl
Technical InformationView technical data
  • Data Sheet
  • Reference
Purchase by sweeping
  • Summary

    Arl3 Protein Q71L mutant [10166]
    [25 µg]


    Catalog Number:  10166
    Product Name:  Arl3 Protein Q71L mutant
    Synonyms:  ADP-ribosylation factor-like 3, ARFL3
    Source:   Human, recombinant full length, His6-tag
    Expression Host:   E. coli
    Molecular Weight:   20 kDa
    Purity:   >95% by SDS-PAGE
    Introduction:   Arl3 belongs to the member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases. Arl3 is also a member of the ADP-ribosylation factor family of GTP-binding proteins. Arl3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.
    Amino Acid Sequence   (1-182, Q71L)
    MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWD 
    IGGLRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAA 
    PASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
    Properties
    Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
    Physical Appearance (form):  White or clear
    Concentration:  1 mg/mL
    Storage:   -80°C
    Preparation Instructions:  
    Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arl3 Q71L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.
    References:  
    1. Cavenagh, M. M. et al., J. Biol. Chem. 269: 18937-18942, 1994. 
    2. Grayson, C. et al., Hum. Molec. Genet. 11: 3065-3074, 2002. 
    3. Kim, H.-S. Cytogenet. Cell Genet. 83: 246-only, 1998. 
    4. Schrick, J. JAm. J. Path. 168: 1288-1298, 2006. 
    5. Veltel, S. et al., Nature Struct. Molec. Biol. 15: 373-380, 2008.
    Datasheet:  


      no data