A Helping Hand for Your Research

Phone: 610-945-2007
Fax: 877-271-1876

EN CH

Purified G proteins

PRODUCT CENTER

Rab7 Protein

Price$239.00
BrandNewEastBio   
Place of OriginUSA
Catalog Number10167
ImmunogenE. coli
Size100μl
Technical InformationView technical data
  • Data Sheet
  • Reference
Purchase by sweeping
  • Summary

    Rab7 Protein [10167]
    [100 µg]


    Catalog Number:  10167
    Product Name:  Rab7 Protein
    Synonyms:  Member RAS oncogene family, Rab7a, MGC102153
    Source:   Human, recombinant full length, His6-tag
    Expression Host:   E. coli
    Molecular Weight:   23 kDa
    Purity:   >95% by SDS-PAGE
    Introduction:   Members of the Rab family of Ras-related GTP-binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. Rab7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.
    Amino Acid Sequence   (1-207)
    MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQ 
    ERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQV 
    ATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC
    Properties
    Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
    Physical Appearance (form):  White or clear
    Concentration:  1 mg/mL
    Storage:   -80°C
    Preparation Instructions:  
    Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab7 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.
    References:  
    1. Edinger, A. L. et al., Dev. Cell 5: 571-582, 2003. 2. Houlden, H. et al., Ann. Neurol. 56: 586-590, 2004. 
    3. Meggouh, F. et al., Neurology 67: 1476-1478, 2006. 
    4. Rak, A. et al., Cell 117: 749-760, 2004. 
    5. Verhoeven, K. et al., Am. J. Hum. Genet. 72: 722-727, 2003.
    Datasheet:  


      no data