A Helping Hand for Your Research

Phone: 610-945-2007
Fax: 877-271-1876

EN CH

Purified G proteins

PRODUCT CENTER

RalB Protein

Price$239.00
BrandNewEastBio   
Place of OriginUSA
Catalog Number10169
ImmunogenE. coli
Size100μl
Technical InformationView technical data
  • Data Sheet
  • Reference
Purchase by sweeping
  • Summary

    RalB Protein [10169]
    [100 µg]


    Catalog Number:  10169
    Product Name:  RalB Protein
    Synonyms:  v-ral simian leukemia viral oncogene homolog B
    Source:   Human, recombinant full length, His6-tag
    Expression Host:   E. coli
    Molecular Weight:    23 kDa
    Purity:    >95% by SDS-PAGE
    Introduction:   The Ras-like small G proteins, RalA/B, are important components of Ras signaling pathways, implicated in the initiation and maintenance of tumorigenic transformation, as well as vesicle transport, apoptosis, transcription, cell migration, and cell proliferation.
    Amino Acid Sequence   (1-206)
    MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDIL 
    DTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEE 
    RRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
    Properties
    Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
    Physical Appearance (form):  White or clear
    Concentration:  1 mg/mL
    Storage:   -80°C
    Preparation Instructions:  
    Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged RalB was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.
    References:  
    1. Chien, Y. et al., Cell 127: 157-170, 2006. 
    2. Hsieh, C.-L. et al., Somat. Cell Molec. Genet. 16: 407-410, 1990
    Datasheet:  


      no data