Email: info@neweastbio.com   |  Call: 6109452007

Rab4A(Q67L) Protein

Rab4A Protein Q67L mutant
5/5

$274.00

Cat.#:  10131

   Size:   25 μl

In Stock

          Product Description          

Rab4A(Q67L) Mutant

Cat. #:  10131
Product Name:  Rab4A Protein Q67L mutant
Synonyms:  Member RAS oncogene family, RAB4, HRES-1/RAB4
Source:   Human, recombinant full length, His6-tag
Expression Host Species:   E. coli
Molecular Weight:   24 kDa
Purity:   >95% by SDS-PAGE
Introduction:   The Rab family of Ras-related GTP-binding protein Rab4 is involved in bidirectional sarcolemmal-vesicular Adrb2 trafficking, which occurs continuously in healthy hearts and is necessary for normal baseline adrenergic responsiveness and resensitization after catecholamine exposure.
Amino Acid Sequence   (1-213, Q67L)
MSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGL
ERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFL
EASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRA
QAPNAQECGC
Properties
Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
Physical Appearance (form):  White or clear
Concentration:  1 mg/mL
Storage:   -80°C
Preparation Instructions:  
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab4A Q67L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.


References:  
1. Barbosa, M. D. F. S. et al., Genomics 30: 439-444, 1995.
2. Odley, A. et al., Proc. Nat. Acad. Sci. 101: 7082-7087, 2004.
3. Rousseau-Merck, M.-F. et al., Hum. Genet. 86: 350-354, 1991.
4. Zahraoui, A. et al., J. Biol. Chem. 264: 12394-12401, 1989.

          Publications