NewEast Biosciences pioneered the research and development of the antibodies for GTPases and mutated Oncogene ten years ago. GTPases involve (1) signal transduction in response to activation of cell surface receptors, including transmembrane receptors such as those mediating taste, smell and vision, (2) protein biosynthesis at the ribosome, (3) regulation of cell differentiation, proliferation, division and movement, (4) translocation of proteins through membranes, (5) transport of vesicles within the cell, and vesicle-mediated secretion and uptake, through GTPase control of vesicle coat assembly. An oncogene is a gene that has the potential to cause cancer.
We offer three unique categories of antibodies, which (1) recognize only the active configuration of GTPase (not the inactive one), (2) mutated Oncogene (not mild type) and (3) have super affinity for cAMP and cGMP (no acetylation required). We have over one thousand peer reviewed articles cited our products.
$349.00
Cat.#: N226082 | ||||||
Product Name: Anti-TREM2 Rabbit pAb | ||||||
Synonyms: TREM2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on myeloid cells 2 | ||||||
UNIPROT ID: Q9NZC2 | ||||||
Background: This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms. | ||||||
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS | ||||||
Applications: WB,IHC-P,ICC/IF | ||||||
Recommended Dilutions: WB: 1/500-1/1000 IHC: 1/50-1/100 IF: 1/50-1/200 | ||||||
Host Species: Rabbit | ||||||
Clonality: Rabbit Polyclonal | ||||||
Clone ID: – | ||||||
MW: Calculated MW: 25 kDa; Observed MW: 25,35-50 kDa | ||||||
Isotype: IgG | ||||||
Purification: Affinity Purified | ||||||
Species Reactivity: Human,Mouse,Rat | ||||||
Conjugation: Unconjugated | ||||||
Modification: Unmodified | ||||||
Constituents: PBS (without Mg2+ and Ca2+), pH 7.3 containing 50% glycerol, 0.5% BSA and 0.02% sodium azide | ||||||
Research Areas: Immunology | ||||||
Storage & Shipping: Store at -20°C. Avoid repeated freezing and thawing | ||||||
|