NewEast Biosciences pioneered the research and development of the antibodies for GTPases and mutated Oncogene ten years ago. GTPases involve (1) signal transduction in response to activation of cell surface receptors, including transmembrane receptors such as those mediating taste, smell and vision, (2) protein biosynthesis at the ribosome, (3) regulation of cell differentiation, proliferation, division and movement, (4) translocation of proteins through membranes, (5) transport of vesicles within the cell, and vesicle-mediated secretion and uptake, through GTPase control of vesicle coat assembly. An oncogene is a gene that has the potential to cause cancer.
We offer three unique categories of antibodies, which (1) recognize only the active configuration of GTPase (not the inactive one), (2) mutated Oncogene (not mild type) and (3) have super affinity for cAMP and cGMP (no acetylation required). We have over one thousand peer reviewed articles cited our products.
$347.00
Arf1(Δ17Q71L) Mutant
Cat. #: 10123 |
Product Name: Arf1 Protein Δ17 Q71L mutant |
Synonyms: ADP-ribosylation factor 1 |
Source: Human recombinant, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 21 kDa |
Purity: >95% by SDS-PAGE |
Introduction: Arf1 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. |
Amino Acid Sequence (1-181, Δ17, Q71L) |
MGNIFANLFKGLFGKK-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD VGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAM NAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside(DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arf1 Δ17Q71L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining |
References:
1. Amor, J. C. et al., Nature 372: 704-708, 1994.
2. Bobak, D. A. et al., Proc. Nat. Acad. Sci. 86: 6101-6105, 1989.
3. Hirai, M. et al., Genomics 34: 263-265, 1996.
4. Kumari, S. et al., Cell Biol. 10: 30-41, 2008.
5. Lee, C.-M. et al., J. Biol. Chem. 267: 9028-9034, 1992.
6. Mossessova, E. et al., Cell 92: 415-423, 1998.
7. Peng, Z. G. et al., Biofactors 2: 45-49, 1989.
8. Presley, J. F. et al., Nature 417: 187-193, 2002.
9. Renault, L. et al., Nature 426: 525-530, 2003.