NewEast Biosciences pioneered the research and development of the antibodies for GTPases and mutated Oncogene ten years ago. GTPases involve (1) signal transduction in response to activation of cell surface receptors, including transmembrane receptors such as those mediating taste, smell and vision, (2) protein biosynthesis at the ribosome, (3) regulation of cell differentiation, proliferation, division and movement, (4) translocation of proteins through membranes, (5) transport of vesicles within the cell, and vesicle-mediated secretion and uptake, through GTPase control of vesicle coat assembly. An oncogene is a gene that has the potential to cause cancer.
We offer three unique categories of antibodies, which (1) recognize only the active configuration of GTPase (not the inactive one), (2) mutated Oncogene (not mild type) and (3) have super affinity for cAMP and cGMP (no acetylation required). We have over one thousand peer reviewed articles cited our products.
 
														
$347.00
Gαi2(Q205L) Protein
| Cat. #: 10147 | 
| Product Name: Gαi2 Protein Q205L mutant | 
| Synonyms: Guanine nucleotide binding protein, alpha inhibiting activity polypeptide 2, GNAI2, Galphai2 | 
| Source: Human, recombinant full length, His6-tag | 
| Expression Host Species: E. coli | 
| Molecular Weight: 40 kDa | 
| Purity: >95% by SDS-PAGE | 
| Introduction: Heterotrimeric G proteins are critical cellular signal transducers. Gαi represents one sub-family of G proteins that could mediate the inhibition of adenylyl cyclases. Other biochemical and physiological functions of Gαi proteins are being explored. | 
| Amino Acid Sequence (1-355, Q205L) | 
| MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECR QYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWAD HGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGG LRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDL FEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVI IKNNLKDCGLF | 
| Properties | 
| Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl | 
| Physical Appearance (form): White or clear | 
| Concentration: 1 mg/mL | 
| Storage: -80°C | 
| Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Gαi2 Q205L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining. | 

References:  
1. Blatt, C. et al., Proc. Nat. Acad. Sci. 85: 7642-7646, 1988.
2. Bloch, D. B. et al., Am. J. Hum. Genet. 42: 884-888, 1988.
3. Bray, P. et al., Proc. Nat. Acad. Sci. 84: 5115-5119, 1987.
4. Itoh, H. et al., J. Biol. Chem. 263: 6656-6664, 1988.
5. Lan, K.-L. et al., J. Biol. Chem. 273: 12794-12797, 1998.
6. Neer, E. J. et al., Hum. Genet. 77: 259-262, 1987.
7. Ogden, S. K. et al., Nature 456: 967-970, 2008.