NewEast Biosciences pioneered the research and development of the antibodies for GTPases and mutated Oncogene ten years ago. GTPases involve (1) signal transduction in response to activation of cell surface receptors, including transmembrane receptors such as those mediating taste, smell and vision, (2) protein biosynthesis at the ribosome, (3) regulation of cell differentiation, proliferation, division and movement, (4) translocation of proteins through membranes, (5) transport of vesicles within the cell, and vesicle-mediated secretion and uptake, through GTPase control of vesicle coat assembly. An oncogene is a gene that has the potential to cause cancer.
We offer three unique categories of antibodies, which (1) recognize only the active configuration of GTPase (not the inactive one), (2) mutated Oncogene (not mild type) and (3) have super affinity for cAMP and cGMP (no acetylation required). We have over one thousand peer reviewed articles cited our products.
$347.00
NFE2L2(R34Q) Mutant
Cat. #: 10447 |
Product Name: NFE2L2 Protein R34Q mutant |
Synonyms: Nuclear factor (erythroid-derived 2)-like 2, Nrf2 |
Source: Human, recombinant full length, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 26 kDa |
Purity: >99% by SDS-PAGE |
Introduction: NFE2L2 protein is encoded by NFE2L2 gene. It is a basic leucine zipper protein that regulates the expression of antioxidant proteins that protect against oxidative damage triggered by injury and inflammation. Several drugs that stimulate the NFE2L2 pathway are being studied for treatment of diseases that are caused by oxidative stress. |
Amino Acid Sequence (1-170) |
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSQEVFD FSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQL DEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDAL YFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIE SPVFIATNQAQSPETSVA |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing.The purity of His-tagged NFE2L2 R34Q was determined by SDS-PAGE and Coomassie Brilliant Blue Staining. |
References:
1. Moi P et al., Proc. Natl. Acad. Sci. U.S.A. 91 (21): 9926-30.
2. Gold R et al., N. Engl. J. Med. 367 (12): 1098-107.