NewEast Biosciences pioneered the research and development of the antibodies for GTPases and mutated Oncogene ten years ago. GTPases involve (1) signal transduction in response to activation of cell surface receptors, including transmembrane receptors such as those mediating taste, smell and vision, (2) protein biosynthesis at the ribosome, (3) regulation of cell differentiation, proliferation, division and movement, (4) translocation of proteins through membranes, (5) transport of vesicles within the cell, and vesicle-mediated secretion and uptake, through GTPase control of vesicle coat assembly. An oncogene is a gene that has the potential to cause cancer.
We offer three unique categories of antibodies, which (1) recognize only the active configuration of GTPase (not the inactive one), (2) mutated Oncogene (not mild type) and (3) have super affinity for cAMP and cGMP (no acetylation required). We have over one thousand peer reviewed articles cited our products.
$239.00
Arl3 Protein
[100 µg]
Cat. #: 10152 |
Product Name: Arl3 Protein |
Synonyms: ADP-ribosylation factor-like 3, ARFL3 |
Source: Human, recombinant full length, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 20 kDa |
Purity: >95% by SDS-PAGE |
Introduction: Arl3 belongs to the member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases. Arl3 is also a member of the ADP-ribosylation factor family of GTP-binding proteins. Arl3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. |
Amino Acid Sequence (1-182) |
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWD IGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAA PASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arl3 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
References:
1. Cavenagh, M. M. et al., J. Biol. Chem. 269: 18937-18942, 1994.
2. Grayson, C. et al., Hum. Molec. Genet. 11: 3065-3074, 2002.
3. Kim, H.-S. Cytogenet. Cell Genet. 83: 246-only, 1998.
4. Schrick, J. JAm. J. Path. 168: 1288-1298, 2006.
5. Veltel, S. et al., Nature Struct. Molec. Biol. 15: 373-380, 2008.