Email: info@neweastbio.com   |  Call: 6109452007

Arl3 Protein

Arl3 Protein
5/5

$239.00

Cat.#:  10152

   Size:   100 μl

In Stock

          Product Description          

Arl3 Protein
[100 µg]

Cat. #:  10152
Product Name:  Arl3 Protein
Synonyms:  ADP-ribosylation factor-like 3, ARFL3
Source:   Human, recombinant full length, His6-tag
Expression Host Species:   E. coli
Molecular Weight:   20 kDa
Purity:   >95% by SDS-PAGE
Introduction:   Arl3 belongs to the member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases. Arl3 is also a member of the ADP-ribosylation factor family of GTP-binding proteins. Arl3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.
Amino Acid Sequence   (1-182)
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWD
IGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAA
PASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Properties
Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
Physical Appearance (form):  White or clear
Concentration:  1 mg/mL
Storage:   -80°C
Preparation Instructions:  
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arl3 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.


References:  
1. Cavenagh, M. M. et al., J. Biol. Chem. 269: 18937-18942, 1994.
2. Grayson, C. et al., Hum. Molec. Genet. 11: 3065-3074, 2002.
3. Kim, H.-S. Cytogenet. Cell Genet. 83: 246-only, 1998.
4. Schrick, J. JAm. J. Path. 168: 1288-1298, 2006.
5. Veltel, S. et al., Nature Struct. Molec. Biol. 15: 373-380, 2008.

          Publications