$239.00
Cat. #: 10156 |
Product Name: Arl1 Protein Q71L mutant |
Synonyms: ADP-ribosylation factor-like 1, ARFL1 |
Source: Human, recombinant full length, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 20 kDa |
Purity: >95% by SDS-PAGE |
Introduction: Arl1 is a member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. |
Amino Acid Sequence (1-181, Q71L) |
MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWD LGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAM TSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arl1 Q71L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining |