Email: info@neweastbio.com   |  Call: 6109452007

Gαi2(Q205L) Protein

i2 Protein Q205L
5/5

$347.00

Cat.#:  10147

   Size:   10 μl

In Stock

            Product Description          

i2(Q205L) Protein

Cat. #:  10147
Product Name:  i2 Protein Q205L mutant
Synonyms:  Guanine nucleotide binding protein, alpha inhibiting activity polypeptide 2, GNAI2, Galphai2
Source:   Human, recombinant full length, His6-tag
Expression Host Species:   E. coli
Molecular Weight:   40 kDa
Purity:   >95% by SDS-PAGE
Introduction:   Heterotrimeric G proteins are critical cellular signal transducers. Gαi represents one sub-family of G proteins that could mediate the inhibition of adenylyl cyclases. Other biochemical and physiological functions of Gαi proteins are being explored.
Amino Acid Sequence   (1-355, Q205L)
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECR
QYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWAD
HGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGG
LRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDL FEEKITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVI IKNNLKDCGLF
Properties
Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl
Physical Appearance (form):  White or clear
Concentration:  1 mg/mL
Storage:   -80°C
Preparation Instructions:  
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Gαi2 Q205L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.


References:  
1. Blatt, C. et al., Proc. Nat. Acad. Sci. 85: 7642-7646, 1988.
2. Bloch, D. B. et al., Am. J. Hum. Genet. 42: 884-888, 1988.
3. Bray, P. et al., Proc. Nat. Acad. Sci. 84: 5115-5119, 1987.
4. Itoh, H. et al., J. Biol. Chem. 263: 6656-6664, 1988.
5. Lan, K.-L. et al., J. Biol. Chem. 273: 12794-12797, 1998.
6. Neer, E. J. et al., Hum. Genet. 77: 259-262, 1987.
7. Ogden, S. K. et al., Nature 456: 967-970, 2008.

          Publications