Email: info@neweastbio.com   |  Call: 6109452007

NFE2L2 Protein

NFE2L2 Protein
5/5

$347.00

Cat.#:  10445

   Size:   100 μl

In Stock

          Product Description          

NFE2L2 Protein

Cat. #:  10445
Product Name:  NFE2L2 Protein
Synonyms:  Nuclear factor (erythroid-derived 2)-like 2, Nrf2
Source:   Human, recombinant full length, His6-tag
Expression Host Species:   E. coli
Molecular Weight:   26 kDa
Purity:   >95% by SDS-PAGE
Introduction:   NFE2L2 protein is encoded by NFE2L2 gene. It is a basic leucine zipper protein that regulates the expression of antioxidant proteins that protect against oxidative damage triggered by injury and inflammation. Several drugs that stimulate the NFE2L2 pathway are being studied for treatment of diseases that are caused by oxidative stress.
Amino Acid Sequence   (1-170)
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFD
FSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQL
DEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDAL
YFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIE
SPVFIATNQAQSPETSVA
Properties
Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
Physical Appearance (form):  White or clear
Concentration:  1 mg/mL
Storage:   -80°C
Preparation Instructions:  
Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing. The purity of His-tagged NFE2L2 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.


References:  
1. Cavenagh, M. M. et al., J. Biol. Chem. 271: 21767-21774, 1996.
2. 2. Gold R et al., N. Engl. J. Med. 367 (12): 1098-107.

          Publications