$347.00
NFE2L2(V32T) Mutant
Cat. #: 10452 |
Product Name: NFE2L2 Protein V32T mutant |
Synonyms: Nuclear factor (erythroid-derived 2)-like 2, Nrf2 |
Source: Human, recombinant full length, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 26 kDa |
Purity: >99% by SDS-PAGE |
Introduction: NFE2L2 protein is encoded by NFE2L2 gene. It is a basic leucine zipper protein that regulates the expression of antioxidant proteins that protect against oxidative damage triggered by injury and inflammation. Several drugs that stimulate the NFE2L2 pathway are being studied for treatment of diseases that are caused by oxidative stress. |
Amino Acid Sequence (1-170) |
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGTSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDAL YFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing. |
The purity of His-tagged NFE2L2 V32T was determined by SDS-PAGE and Coomassie Brilliant Blue Staining.
References:
1. Moi P et al., Proc. Natl. Acad. Sci. U.S.A. 91 (21): 9926-30.
2. Gold R et al., N. Engl. J. Med. 367 (12): 1098-107.