Email: info@neweastbio.com   |  Call: 6109452007

Rab7 Protein

Rab7 Protein
5/5

$255.00

Cat.#:  10167

   Size:   100 μl

In Stock

          Product Description          
Rab7 Protein [100 µg]
Cat. #:  10167
Product Name:  Rab7 Protein
Synonyms:  Member RAS oncogene family, Rab7a, MGC102153
Source:   Human, recombinant full length, His6-tag
Expression Host Species:   E. coli
Molecular Weight:   23 kDa
Purity:   >95% by SDS-PAGE
Introduction:   Members of the Rab family of Ras-related GTP-binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. Rab7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori.
Amino Acid Sequence   (1-207)
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQ ERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQV ATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC
Properties
Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
Physical Appearance (form):  White or clear
Concentration:  1 mg/mL
Storage:   -80°C
Preparation Instructions:   Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab7 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.
References:   1. Edinger, A. L. et al., Dev. Cell 5: 571-582, 2003. 2. Houlden, H. et al., Ann. Neurol. 56: 586-590, 2004. 3. Meggouh, F. et al., Neurology 67: 1476-1478, 2006. 4. Rak, A. et al., Cell 117: 749-760, 2004. 5. Verhoeven, K. et al., Am. J. Hum. Genet. 72: 722-727, 2003.
          Publications