Email: info@neweastbio.com   |  Call: 6109452007

RalB Protein

RalB Protein
5/5

$239.00

Cat.#:  10169

   Size:   100 μl

In Stock

          Product Description          
RalB Protein
Cat. #:  10169
Product Name:  RalB Protein
Synonyms:  v-ral simian leukemia viral oncogene homolog B
Source:   Human, recombinant full length, His6-tag
Expression Host Species:   E. coli
Molecular Weight:    23 kDa
Purity:    >95% by SDS-PAGE
Introduction:   The Ras-like small G proteins, RalA/B, are important components of Ras signaling pathways, implicated in the initiation and maintenance of tumorigenic transformation, as well as vesicle transport, apoptosis, transcription, cell migration, and cell proliferation.
Amino Acid Sequence   (1-206)
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDIL DTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEE RRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
Properties
Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
Physical Appearance (form):  White or clear
Concentration:  1 mg/mL
Storage:   -80°C
Preparation Instructions:   Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged RalB was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.
References:   1. Chien, Y. et al., Cell 127: 157-170, 2006. 2. Hsieh, C.-L. et al., Somat. Cell Molec. Genet. 16: 407-410, 1990
          Publications