NewEast Biosciences pioneered the research and development of the antibodies for GTPases and mutated Oncogene ten years ago. GTPases involve (1) signal transduction in response to activation of cell surface receptors, including transmembrane receptors such as those mediating taste, smell and vision, (2) protein biosynthesis at the ribosome, (3) regulation of cell differentiation, proliferation, division and movement, (4) translocation of proteins through membranes, (5) transport of vesicles within the cell, and vesicle-mediated secretion and uptake, through GTPase control of vesicle coat assembly. An oncogene is a gene that has the potential to cause cancer.
We offer three unique categories of antibodies, which (1) recognize only the active configuration of GTPase (not the inactive one), (2) mutated Oncogene (not mild type) and (3) have super affinity for cAMP and cGMP (no acetylation required). We have over one thousand peer reviewed articles cited our products.
$239.00
Ran(Q69L) Mutant
Cat. #: 10113 |
Product Name: Ran Protein Q69L mutant |
Synonyms: Ras-related nuclear protein, TC4, Gsp1, ARA24 |
Source: Human, recombinant full length, His6-tag |
Expression Host Species: E. coli |
Molecular Weight: 24 kDa |
Purity: >95% by SDS-PAGE |
Introduction: Ran is a member of the Ras-superfamily GTPases. Ran is invovled in control of DNA synthesis and of cell cycle progression, and the transport of proteins across the nuclear envelope, as well as in microtubule organization during mitosis. |
Amino Acid Sequence (1-216, Q69L) |
MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTA GLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAK SIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLE VAQTTALPDEDDDL |
Properties |
Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
Physical Appearance (form): White or clear |
Concentration: 1 mg/mL |
Storage: -80°C |
Preparation Instructions: Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Ran Q69L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining. |
References:
1. Carazo-Salas, R. E. et al., Nature 400: 178-181, 1999.
2. Caudron, M. et al., Science 309: 1373-1376, 2005.
3. Kalab, P. et al., Nature 440: 697-701, 2006.
4. Lee, S. J. et al., Nature 435: 693-696, 2005.
5. Monecke, T. et al., Science 324: 1087-1091, 2009.
6. Ohba, T. et al., Science 284: 1356-1358, 1999.
7. Seewald, M. J. et al., Nature 415: 662-666, 2002.
8. Smith, A. E. et al., Science 295: 488-491, 2002.
9. Walther, T. C. et al., Nature 424: 689-694, 2003.
10. Wiese, C. et al., Science 291: 653-656, 2001.
1. NMDAR signaling facilitates the IPO5-mediated nuclear import of CPEB3 Nucleic Acids Res. 2012 Sep 1;40(17):8484-98 |