RhoA Protein

Cat.#:  10104

Product Name:  RhoA Protein

Synonyms:  Ras homolog gene family, member A, ARHA, ARH12, RHO12, RHOH12

Source:   Human, recombinant full length, His6-tag

Expression Host Species:   E. coli

Molecular Weight:   22 kDa

Purity:    >96% by SDS-PAGE

Introduction:   Small GTPases are a super-family of cellular signaling regulators. RhoA belongs to the Rho sub-family of GTPases. Rho proteins play critical roles in many actin cytoskeleton- dependent processes including platelet aggregation, cell motility, contraction, and cytokinesis. It regulates the formation of stress fibers and focal adhesions in fibroblasts and Ca2+ sensitivity of smooth muscle contraction.

Amino Acid Sequence   (1-193)

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYD RLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKM KQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Properties

Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form):  White or clear

Concentration:  1 mg/mL

Storage:   -80°C

Preparation Instructions:   Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged RhoA was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References:   1. Canman, J. C. et al., Science 322: 1543-1546, 2008. 2. Guilluy, C. et al., Nature Med. 16: 183-190, 2010. 3. Machacek, M. et al., Nature 461: 99-103, 2009 4. Nakamura, M. et al., Invest. Ophthal. Vis. Sci. 42: 941-947, 2001. 5. Rao, P. V. et al., Invest. Ophthal. Vis. Sci. 42: 1029-1037, 2001. 6. Valderrama, F. et al., Science 311: 377-381, 2006. 7. Wang, H.-R. et al., Science 302: 1775-1779, 2003. 8. Wu, K. Y. et al., Nature 436: 1020-1024, 2005. 9. Yoshida, S.et al., Science 313: 108-111, 2006.