Pioneering GTPase and Oncogene Product Development since 2010

Email us: info@neweastbio.com

Call us: 6109452007

Sar1a Protein

Sar1a Protein
5/5

$349.00

Cat.#:  10114

   Size:   100 μl

In Stock

            Product Description          

Sar1a Protein

Cat. #:  10114
Product Name:  Sar1a Protein
Synonyms:  SAR1 homolog A, SAR1, Sara, SARA1, Masra2
Source:   Human, recombinant full length, His6-tag
Expression Host Species:    E. coli
Molecular Weight:   22 kDa
Purity:   >95% by SDS-PAGE
Introduction:   Small GTPases are a super-family of cellular signaling regulators. Sar1 is a member of these small GTPases. Sar1 functions as a molecular switch to control protein–protein and protein–lipid interactions that direct vesicle budding from the ER.
Amino Acid Sequence   (1-198)
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIA
GMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGN
KIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID
Properties
Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
Physical Appearance (form):  White or clear
Concentration:   1 mg/mL
Storage:   -80°C
Preparation Instructions:  
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Sar1a was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.


References:  
1. He, H. et al., Gene Expr. 10: 231-242, 2002.
2. Jones, B. et al., Nature Genet. 34: 29-31, 2003.
3. South, S. T. et al., J. Cell Biol. 149: 1345-1359, 2000.

          Publications