Pioneering GTPase and Oncogene Product Development since 2010

Email us: info@neweastbio.com

Call us: 6109452007

Rab5 Protein,ΔN15

Rab5 Protein,ΔN15
5/5

$239.00

Cat.#:  10116

   Size:   100 μl

In Stock

            Product Description          

Rab5(ΔN15) Protein

Cat. #:  10116
Product Name:  Rab5 Protein
Synonyms:  Member RAS oncogene family, RAB5A
Source:   Human, recombinant full length, His6-tag
Expression Host Species:   E. coli
Molecular Weight:   17 kDa
Purity:   >95% by SDS-PAGE
Introduction:   Rab5, consists of three isoforms, Rab5A, Rab5B, and Rab5C, is a small GTPase that is localized to early endosomes. It regulates the fusion between endocytic vesicles and early endosomes, as well as the homotypic fusion between early endosomes.
Amino Acid Sequence   (16-184)
NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERY
HSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQ
SYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKN
Properties
Physical Appearance (form):   Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.
Physical Appearance (form):  White or clear
Concentration:  1 mg/mL
Storage:   -80°C
Preparation Instructions:  
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab5 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining


References:  
1. Bucci, C. et al., Cell 70: 715-728, 1992.
2. Kinchen, J. M. et al., Nature 464: 778-782, 2010.
3. Kitano, M. et al., Nature 453: 241-245, 2008.
4. Lanzetti, L. et al., Nature 429: 309-314, 2004.
5. Lanzetti, L. et al., Nature 408: 374-377, 2000.
6. Miaczynska, M. et al., Cell 116: 445-456, 2004.
7. Ohya, T. et al., Nature 459: 1091-1097, 2009.
8. Otomo, A. et al., Hum. Molec. Genet. 12: 1671-1687, 2003.
9. Rousseau-Merck, M. F. et al., Hum. Genet. 86: 350-354, 1991.
10. Stenmark, H. et al., Cell 83: 423-432, 1995.
11. Xiao, G.-H. et al., J. Biol. Chem. 272: 6097-6100, 1997.
12. Zahraoui, A. et al., J. Biol. Chem. 264: 12394-12401, 1989.

          Publications